PDB entry 1zh5

View 1zh5 on RCSB PDB site
Description: Structural basis for recognition of UUUOH 3'-terminii of nascent RNA pol III transcripts by La autoantigen
Class: transcription/RNA
Keywords: TRANSCRIPTION/RNA, TRANSCRIPTION-RNA complex
Deposited on 2005-04-22, released 2006-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.203
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lupus La protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ssb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05455
      • modified residue (10)
      • modified residue (52)
      • modified residue (80)
      • modified residue (142)
    Domains in SCOPe 2.07: d1zh5a1, d1zh5a2
  • Chain 'B':
    Compound: Lupus La protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ssb
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05455
      • modified residue (10)
      • modified residue (52)
      • modified residue (80)
      • modified residue (142)
    Domains in SCOPe 2.07: d1zh5b1, d1zh5b2
  • Chain 'C':
    Compound: 5'-r(*up*gp*cp*up*gp*up*up*up*u)-3'
  • Chain 'D':
    Compound: 5'-r(*up*gp*cp*up*gp*up*up*up*u)-3'
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zh5A (A:)
    smaengdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrln
    rlttdfnvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfp
    tdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketd
    llilfkddyfakkne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zh5A (A:)
    gdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttd
    fnvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptdatl
    ddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdllilf
    kddyf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zh5B (B:)
    smaengdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrln
    rlttdfnvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfp
    tdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketd
    llilfkddyfakkne
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zh5B (B:)
    dnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdf
    nvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptdatld
    dikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdllilfk
    ddyf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.