SCOPe 2.08: Domain d1zh5b2: 1zh5 B:104-189

Lineage for d1zh5b2 (1zh5 B:104-189)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Lupus LA protein [89940] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89941] (8 PDB entries)

8. Domain d1zh5b2: 1zh5 B:104-189 [125076]
   Other proteins in same PDB: d1zh5a1, d1zh5b1
   automated match to d1zh5a2
   protein/RNA complex; complexed with so4

Details for d1zh5b2

PDB Entry: 1zh5, 1.85 Å

PDB Description: Structural basis for recognition of UUUOH 3'-terminii of nascent RNA pol III transcripts by La autoantigen

PDB Compounds: (B:) Lupus La protein

SCOPe Domain Sequences for d1zh5b2:

Sequence; same for both SEQRES and ATOM records:

>d1zh5b2 d.58.7.1 (B:104-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]}
ykndvknrsvyikgfptdatlddikewledkgqvlniqmrrtlhkafkgsifvvfdsies
akkfvetpgqkyketdllilfkddyf

Timeline for d1zh5b2:

• d1zh5b2 first appeared in SCOP 1.73
  
• d1zh5b2 appears in SCOPe 2.07