SCOPe 2.06: Domain d1zc3b_: 1zc3 B:

Lineage for d1zc3b_ (1zc3 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein automated matches [190063] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [188181] (2 PDB entries)

8. Domain d1zc3b_: 1zc3 B: [124881]
   Other proteins in same PDB: d1zc3a1, d1zc3c_
   automated match to d1zc3b1
   complexed with gnp, mg

Details for d1zc3b_

PDB Entry: 1zc3, 2 Å

PDB Description: crystal structure of the ral-binding domain of exo84 in complex with the active rala

PDB Compounds: (B:) exocyst complex protein Exo84

SCOPe Domain Sequences for d1zc3b_:

Sequence; same for both SEQRES and ATOM records:

>d1zc3b_ b.55.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv
nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkr

Timeline for d1zc3b_:

• d1zc3b_ first appeared in SCOP 1.73, called d1zc3b1
  
• d1zc3b_ appears in SCOPe 2.05
  
• d1zc3b_ appears in SCOPe 2.07
  
• d1zc3b_ appears in the current release, SCOPe 2.08