Lineage for d1zc3b_ (1zc3 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412582Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2412583Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2412584Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2412853Protein automated matches [190063] (3 species)
    not a true protein
  7. 2412878Species Norway rat (Rattus norvegicus) [TaxId:10116] [188181] (2 PDB entries)
  8. 2412879Domain d1zc3b_: 1zc3 B: [124881]
    Other proteins in same PDB: d1zc3a1, d1zc3c_
    automated match to d1zc3b1
    complexed with gnp, mg

Details for d1zc3b_

PDB Entry: 1zc3 (more details), 2 Å

PDB Description: crystal structure of the ral-binding domain of exo84 in complex with the active rala
PDB Compounds: (B:) exocyst complex protein Exo84

SCOPe Domain Sequences for d1zc3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zc3b_ b.55.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv
nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkr

SCOPe Domain Coordinates for d1zc3b_:

Click to download the PDB-style file with coordinates for d1zc3b_.
(The format of our PDB-style files is described here.)

Timeline for d1zc3b_: