Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein automated matches [190063] (3 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [188181] (2 PDB entries) |
Domain d1zc3d_: 1zc3 D: [124883] Other proteins in same PDB: d1zc3a1, d1zc3c_ automated match to d1zc3b1 complexed with gnp, mg |
PDB Entry: 1zc3 (more details), 2 Å
SCOPe Domain Sequences for d1zc3d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zc3d_ b.55.1.1 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} gqylvyngdlveyeadhmaqlqrvhgflmndcllvatwlpqrrgmyrynalypldrlavv nvkdnppmkdmfkllmfpesrifqaenakikrewlevleetkralsdkr
Timeline for d1zc3d_: