![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.61: ImpE-like [144058] (1 superfamily) consists of two domains; d1: right-handed superhelix of five helices; d2: pseudo beta-barrel containing structurally similar part to the "Histone-like" proteins from archaea (54161) |
![]() | Superfamily e.61.1: ImpE-like [144059] (1 family) ![]() |
![]() | Family e.61.1.1: ImpE-like [144060] (1 protein) Pfam PF07024 |
![]() | Protein Hypothetical protein VPA1032 [144061] (1 species) |
![]() | Species Vibrio parahaemolyticus [TaxId:670] [144062] (1 PDB entry) Uniprot Q87HD3 2-265 |
![]() | Domain d1zbpa1: 1zbp A:2-265 [124861] Other proteins in same PDB: d1zbpa2 |
PDB Entry: 1zbp (more details), 2.4 Å
SCOPe Domain Sequences for d1zbpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} tqwknalsegqlqqalellieaikaspkdaslrssfiellcidgdferadeqlmqsiklf peylpgasqlrhlvkaaqarkdfaqgaatakvlgeneeltkslvsfnlsmvsqdyeqvse lalqieelrqekgflandtsfsdvrdiddrlggyielfstagnyflvpiasintleiksa tsllesvwrpvefdidglgegeghmpmtyvdsesdaqklgretdwkqiadkevylglglk cwlvgemalpisdlqnlqvikela
Timeline for d1zbpa1: