SCOPe 2.08: Domain d1zbpa1: 1zbp A:2-265

Lineage for d1zbpa1 (1zbp A:2-265)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.61: ImpE-like [144058] (1 superfamily)
   consists of two domains; d1: right-handed superhelix of five helices; d2: pseudo beta-barrel containing structurally similar part to the "Histone-like" proteins from archaea (54161)

4. Superfamily e.61.1: ImpE-like [144059] (1 family)

5. Family e.61.1.1: ImpE-like [144060] (1 protein)
   Pfam PF07024

6. Protein Hypothetical protein VPA1032 [144061] (1 species)

7. Species Vibrio parahaemolyticus [TaxId:670] [144062] (1 PDB entry)
   Uniprot Q87HD3 2-265

8. Domain d1zbpa1: 1zbp A:2-265 [124861]
   Other proteins in same PDB: d1zbpa2

Details for d1zbpa1

PDB Entry: 1zbp, 2.4 Å

PDB Description: x-ray crystal structure of protein vpa1032 from vibrio parahaemolyticus. northeast structural genomics consortium target vpr44

PDB Compounds: (A:) hypothetical protein VPA1032

SCOPe Domain Sequences for d1zbpa1:

Sequence; same for both SEQRES and ATOM records:

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}
tqwknalsegqlqqalellieaikaspkdaslrssfiellcidgdferadeqlmqsiklf
peylpgasqlrhlvkaaqarkdfaqgaatakvlgeneeltkslvsfnlsmvsqdyeqvse
lalqieelrqekgflandtsfsdvrdiddrlggyielfstagnyflvpiasintleiksa
tsllesvwrpvefdidglgegeghmpmtyvdsesdaqklgretdwkqiadkevylglglk
cwlvgemalpisdlqnlqvikela

Timeline for d1zbpa1:

• d1zbpa1 first appeared in SCOP 1.73
  
• d1zbpa1 appears in SCOPe 2.07