PDB entry 1zbp

View 1zbp on RCSB PDB site
Description: X-Ray Crystal Structure of Protein VPA1032 from Vibrio parahaemolyticus. Northeast Structural Genomics Consortium Target VpR44
Class: structural genomics, unknown function
Keywords: alpha-beta protein, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, UNKNOWN FUNCTION
Deposited on 2005-04-08, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein VPA1032
    Species: Vibrio parahaemolyticus [TaxId:223926]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q87HD3 (Start-264)
      • modified residue (54)
      • modified residue (110)
      • modified residue (205)
      • modified residue (207)
      • modified residue (247)
      • cloning artifact (265-266)
    Domains in SCOPe 2.07: d1zbpa1, d1zbpa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zbpA (A:)
    mtqwknalsegqlqqalellieaikaspkdaslrssfiellcidgdferadeqlmqsikl
    fpeylpgasqlrhlvkaaqarkdfaqgaatakvlgeneeltkslvsfnlsmvsqdyeqvs
    elalqieelrqekgflandtsfsdvrdiddrlggyielfstagnyflvpiasintleiks
    atsllesvwrpvefdidglgegeghmpmtyvdsesdaqklgretdwkqiadkevylglgl
    kcwlvgemalpisdlqnlqvikelalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zbpA (A:)
    tqwknalsegqlqqalellieaikaspkdaslrssfiellcidgdferadeqlmqsiklf
    peylpgasqlrhlvkaaqarkdfaqgaatakvlgeneeltkslvsfnlsmvsqdyeqvse
    lalqieelrqekgflandtsfsdvrdiddrlggyielfstagnyflvpiasintleiksa
    tsllesvwrpvefdidglgegeghmpmtyvdsesdaqklgretdwkqiadkevylglglk
    cwlvgemalpisdlqnlqvikelale