Lineage for d1zbpa1 (1zbp A:2-265)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2250500Fold e.61: ImpE-like [144058] (1 superfamily)
    consists of two domains; d1: right-handed superhelix of five helices; d2: pseudo beta-barrel containing structurally similar part to the "Histone-like" proteins from archaea (54161)
  4. 2250501Superfamily e.61.1: ImpE-like [144059] (1 family) (S)
  5. 2250502Family e.61.1.1: ImpE-like [144060] (1 protein)
    Pfam PF07024
  6. 2250503Protein Hypothetical protein VPA1032 [144061] (1 species)
  7. 2250504Species Vibrio parahaemolyticus [TaxId:670] [144062] (1 PDB entry)
    Uniprot Q87HD3 2-265
  8. 2250505Domain d1zbpa1: 1zbp A:2-265 [124861]
    Other proteins in same PDB: d1zbpa2

Details for d1zbpa1

PDB Entry: 1zbp (more details), 2.4 Å

PDB Description: x-ray crystal structure of protein vpa1032 from vibrio parahaemolyticus. northeast structural genomics consortium target vpr44
PDB Compounds: (A:) hypothetical protein VPA1032

SCOPe Domain Sequences for d1zbpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}
tqwknalsegqlqqalellieaikaspkdaslrssfiellcidgdferadeqlmqsiklf
peylpgasqlrhlvkaaqarkdfaqgaatakvlgeneeltkslvsfnlsmvsqdyeqvse
lalqieelrqekgflandtsfsdvrdiddrlggyielfstagnyflvpiasintleiksa
tsllesvwrpvefdidglgegeghmpmtyvdsesdaqklgretdwkqiadkevylglglk
cwlvgemalpisdlqnlqvikela

SCOPe Domain Coordinates for d1zbpa1:

Click to download the PDB-style file with coordinates for d1zbpa1.
(The format of our PDB-style files is described here.)

Timeline for d1zbpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zbpa2