Class a: All alpha proteins [46456] (290 folds) |
Fold a.149: RNase III domain-like [69064] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.149.1: RNase III domain-like [69065] (3 families) |
Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins) Pfam PF00636 |
Protein RNase III endonuclease catalytic domain [69067] (2 species) |
Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries) |
Domain d1yywc1: 1yyw C:2-150 [124260] Other proteins in same PDB: d1yywa2, d1yywb2, d1yywc2, d1yywd2 automated match to d1rc7a1 protein/RNA complex |
PDB Entry: 1yyw (more details), 2.8 Å
SCOPe Domain Sequences for d1yywc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yywc1 a.149.1.1 (C:2-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]} kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg rdanftrelfyklfkedilsaikegrvkk
Timeline for d1yywc1: