SCOPe 2.08: Domain d1yywb1: 1yyw B:2-150

Lineage for d1yywb1 (1yyw B:2-150)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.149: RNase III domain-like [69064] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.149.1: RNase III domain-like [69065] (3 families)

5. Family a.149.1.1: RNase III catalytic domain-like [69066] (2 proteins)
   Pfam PF00636

6. Protein RNase III endonuclease catalytic domain [69067] (2 species)

7. Species Aquifex aeolicus [TaxId:63363] [69068] (12 PDB entries)

8. Domain d1yywb1: 1yyw B:2-150 [124258]
   Other proteins in same PDB: d1yywa2, d1yywb2, d1yywc2, d1yywd2
   automated match to d1rc7a1
   protein/RNA complex

Details for d1yywb1

PDB Entry: 1yyw, 2.8 Å

PDB Description: Crystal structure of RNase III from Aquifex aeolicus complexed with double stranded RNA at 2.8-Angstrom Resolution

PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d1yywb1:

Sequence; same for both SEQRES and ATOM records:

>d1yywb1 a.149.1.1 (B:2-150) RNase III endonuclease catalytic domain {Aquifex aeolicus [TaxId: 63363]}
kmleqlekklgytfkdksllekalthvsyskkehyetleflgdalvnffivdllvqyspn
kregflsplkayliseeffnllaqklelhkfirikrgkinetiigdvfealwaavyidsg
rdanftrelfyklfkedilsaikegrvkk

Timeline for d1yywb1:

• d1yywb1 first appeared in SCOP 1.73
  
• d1yywb1 appears in SCOPe 2.07