Lineage for d1yywb2 (1yyw B:151-220)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. Superfamily d.50.1: dsRNA-binding domain-like [54768] (4 families) (S)
  5. Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (13 proteins)
    Pfam PF00035
  6. Protein RNase III, C-terminal domain [54776] (3 species)
  7. Species Aquifex aeolicus [TaxId:63363] [102927] (9 PDB entries)
  8. Domain d1yywb2: 1yyw B:151-220 [124259]
    Other proteins in same PDB: d1yywa1, d1yywb1, d1yywc1, d1yywd1
    automated match to d2nugb2
    protein/RNA complex

Details for d1yywb2

PDB Entry: 1yyw (more details), 2.8 Å

PDB Description: Crystal structure of RNase III from Aquifex aeolicus complexed with double stranded RNA at 2.8-Angstrom Resolution
PDB Compounds: (B:) Ribonuclease III

SCOPe Domain Sequences for d1yywb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yywb2 d.50.1.1 (B:151-220) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]}
dyktilqeitqkrwkerpeyrlisvegphhkkkfiveakikeyrtlgegkskkeaeqraa
eelikllees

SCOPe Domain Coordinates for d1yywb2 are not available.

Timeline for d1yywb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yywb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1yywa1, d1yywa2, d1yywc1, d1yywc2, d1yywd1, d1yywd2