SCOPe 2.02: Domain d1ytzc1: 1ytz C:3-161

Lineage for d1ytzc1 (1ytz C:3-161)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
   Uniprot P09860

8. Domain d1ytzc1: 1ytz C:3-161 [124022]
   Other proteins in same PDB: d1ytzi1, d1ytzt1
   automatically matched to d1ncx__
   complexed with ca, dr6

Details for d1ytzc1

PDB Entry: 1ytz, 3 Å

PDB Description: crystal structure of skeletal muscle troponin in the ca2+-activated state

PDB Compounds: (C:) troponin c

SCOPe Domain Sequences for d1ytzc1:

Sequence; same for both SEQRES and ATOM records:

>d1ytzc1 a.39.1.5 (C:3-161) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
tdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiie
evdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelgeilr
atgehvteediedlmkdsdknndgridfdeflkmmegvq

Timeline for d1ytzc1:

• d1ytzc1 first appeared in SCOP 1.73
  
• d1ytzc1 appears in SCOPe 2.01
  
• d1ytzc1 appears in SCOPe 2.03
  
• d1ytzc1 appears in the current release, SCOPe 2.08, called d1ytzc_