Lineage for d1ytzc_ (1ytz C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994753Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
    Duplication: made with two pairs of EF-hands
  6. 1995233Protein Troponin C [47503] (6 species)
  7. 1995234Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
    Uniprot P09860
  8. 1995243Domain d1ytzc_: 1ytz C: [124022]
    Other proteins in same PDB: d1ytzi1, d1ytzt1
    automated match to d1topa_
    complexed with ca, dr6

Details for d1ytzc_

PDB Entry: 1ytz (more details), 3 Å

PDB Description: Crystal structure of skeletal muscle troponin in the Ca2+-activated state
PDB Compounds: (C:) troponin c

SCOPe Domain Sequences for d1ytzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytzc_ a.39.1.5 (C:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
tdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiie
evdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelgeilr
atgehvteediedlmkdsdknndgridfdeflkmmegvq

SCOPe Domain Coordinates for d1ytzc_:

Click to download the PDB-style file with coordinates for d1ytzc_.
(The format of our PDB-style files is described here.)

Timeline for d1ytzc_: