SCOPe 2.08: Domain d1ytzc_: 1ytz C:

Lineage for d1ytzc_ (1ytz C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Troponin C [47503] (6 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
   Uniprot P09860

8. Domain d1ytzc_: 1ytz C: [124022]
   Other proteins in same PDB: d1ytzi1, d1ytzt1
   automated match to d1topa_
   complexed with ca, dr6

Details for d1ytzc_

PDB Entry: 1ytz, 3 Å

PDB Description: crystal structure of skeletal muscle troponin in the ca2+-activated state

PDB Compounds: (C:) troponin c

SCOPe Domain Sequences for d1ytzc_:

Sequence; same for both SEQRES and ATOM records:

>d1ytzc_ a.39.1.5 (C:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
tdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiie
evdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelgeilr
atgehvteediedlmkdsdknndgridfdeflkmmegvq

Timeline for d1ytzc_:

• d1ytzc_ first appeared in SCOP 1.73, called d1ytzc1
  
• d1ytzc_ appears in SCOPe 2.07