Lineage for d1ytzc1 (1ytz C:3-161)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640657Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 640658Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 640871Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 641184Protein Troponin C [47503] (6 species)
  7. 641185Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
  8. 641194Domain d1ytzc1: 1ytz C:3-161 [124022]
    Other proteins in same PDB: d1ytzi1, d1ytzt1
    automatically matched to d1ncx__
    complexed with ca, dr6

Details for d1ytzc1

PDB Entry: 1ytz (more details), 3 Å

PDB Description: Crystal structure of skeletal muscle troponin in the Ca2+-activated state
PDB Compounds: (C:) troponin c

SCOP Domain Sequences for d1ytzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytzc1 a.39.1.5 (C:3-161) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
tdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiie
evdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelgeilr
atgehvteediedlmkdsdknndgridfdeflkmmegvq

SCOP Domain Coordinates for d1ytzc1:

Click to download the PDB-style file with coordinates for d1ytzc1.
(The format of our PDB-style files is described here.)

Timeline for d1ytzc1: