SCOPe 2.06: Domain d1yr0c_: 1yr0 C:

Lineage for d1yr0c_ (1yr0 C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.0: automated matches [191308] (1 protein)
   not a true family

6. Protein automated matches [190038] (42 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [186886] (1 PDB entry)

8. Domain d1yr0c_: 1yr0 C: [123907]
   Other proteins in same PDB: d1yr0a1
   automated match to d1vhsa_
   complexed with so4

Details for d1yr0c_

PDB Entry: 1yr0, 2 Å

PDB Description: crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens

PDB Compounds: (C:) phosphinothricin acetyltransferase

SCOPe Domain Sequences for d1yr0c_:

Sequence; same for both SEQRES and ATOM records:

>d1yr0c_ d.108.1.0 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
svelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpvivaild
gkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvliaa
ieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelkl

Timeline for d1yr0c_:

• d1yr0c_ first appeared in SCOP 1.73, called d1yr0c1
  
• d1yr0c_ appears in SCOPe 2.05
  
• d1yr0c_ appears in SCOPe 2.07
  
• d1yr0c_ appears in the current release, SCOPe 2.08