SCOP 1.73: Domain d1yr0c1: 1yr0 C:4-166

Lineage for d1yr0c1 (1yr0 C:4-166)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)

6. Protein Phosphinothricin acetyltransferase [143698] (1 species)

7. Species Agrobacterium tumefaciens [TaxId:358] [143699] (1 PDB entry)

8. Domain d1yr0c1: 1yr0 C:4-166 [123907]
   automatically matched to 1YR0 A:4-166
   complexed with so4

Details for d1yr0c1

PDB Entry: 1yr0, 2 Å

PDB Description: crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens

PDB Compounds: (C:) phosphinothricin acetyltransferase

SCOP Domain Sequences for d1yr0c1:

Sequence; same for both SEQRES and ATOM records:

>d1yr0c1 d.108.1.1 (C:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]}
svelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpvivaild
gkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvliaa
ieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelkl

Timeline for d1yr0c1:

• d1yr0c1 is new in SCOP 1.73
  
• d1yr0c1 appears in SCOP 1.75
  
• d1yr0c1 appears in the current release, SCOPe 2.08, called d1yr0c_