![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (49 species) not a true protein |
![]() | Species Agrobacterium tumefaciens [TaxId:176299] [186886] (1 PDB entry) |
![]() | Domain d1yr0c_: 1yr0 C: [123907] Other proteins in same PDB: d1yr0a1 automated match to d1vhsa_ complexed with so4 |
PDB Entry: 1yr0 (more details), 2 Å
SCOPe Domain Sequences for d1yr0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yr0c_ d.108.1.0 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} svelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpvivaild gkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvliaa ieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelkl
Timeline for d1yr0c_: