Lineage for d1yr0b1 (1yr0 B:4-166)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731191Protein Phosphinothricin acetyltransferase [143698] (1 species)
  7. 731192Species Agrobacterium tumefaciens [TaxId:358] [143699] (1 PDB entry)
  8. 731194Domain d1yr0b1: 1yr0 B:4-166 [123906]
    automatically matched to 1YR0 A:4-166
    complexed with so4

Details for d1yr0b1

PDB Entry: 1yr0 (more details), 2 Å

PDB Description: crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
PDB Compounds: (B:) phosphinothricin acetyltransferase

SCOP Domain Sequences for d1yr0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yr0b1 d.108.1.1 (B:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]}
svelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpvivaild
gkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvliaa
ieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelkl

SCOP Domain Coordinates for d1yr0b1:

Click to download the PDB-style file with coordinates for d1yr0b1.
(The format of our PDB-style files is described here.)

Timeline for d1yr0b1: