Lineage for d1yqha1 (1yqh A:1-101)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1207610Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) (S)
  5. 1207611Family d.58.48.1: MTH1187-like [89958] (5 proteins)
    Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix
  6. 1207612Protein Hypothetical protein BC0424 [143405] (1 species)
  7. 1207613Species Bacillus cereus [TaxId:1396] [143406] (1 PDB entry)
    Uniprot Q81IG4 1-101
  8. 1207614Domain d1yqha1: 1yqh A:1-101 [123886]
    Other proteins in same PDB: d1yqhb_

Details for d1yqha1

PDB Entry: 1yqh (more details), 1.7 Å

PDB Description: structure of domain of unknown function duf77 from bacillus cereus
PDB Compounds: (A:) IG hypothetical 16092

SCOPe Domain Sequences for d1yqha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqha1 d.58.48.1 (A:1-101) Hypothetical protein BC0424 {Bacillus cereus [TaxId: 1396]}
msqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldvvkr
aqqacvdagaeevitsikihyrpstgvtidekvwkyrdeya

SCOPe Domain Coordinates for d1yqha1:

Click to download the PDB-style file with coordinates for d1yqha1.
(The format of our PDB-style files is described here.)

Timeline for d1yqha1: