SCOPe 2.02: Domain d1yqhb_: 1yqh B:

Lineage for d1yqhb_ (1yqh B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families)

5. Family d.58.48.0: automated matches [191332] (1 protein)
   not a true family

6. Protein automated matches [190160] (2 species)
   not a true protein

7. Species Bacillus cereus [TaxId:226900] [186884] (1 PDB entry)

8. Domain d1yqhb_: 1yqh B: [123887]
   Other proteins in same PDB: d1yqha1
   automated match to d1vk8a_

Details for d1yqhb_

PDB Entry: 1yqh, 1.7 Å

PDB Description: structure of domain of unknown function duf77 from bacillus cereus

PDB Compounds: (B:) IG hypothetical 16092

SCOPe Domain Sequences for d1yqhb_:

Sequence; same for both SEQRES and ATOM records:

>d1yqhb_ d.58.48.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]}
msqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldvvkr
aqqacvdagaeevitsikihyrpstgvtidekvwkyrdeya

Timeline for d1yqhb_:

• d1yqhb_ first appeared in SCOP 1.73, called d1yqhb1
  
• d1yqhb_ appears in SCOPe 2.01
  
• d1yqhb_ appears in SCOPe 2.03
  
• d1yqhb_ appears in the current release, SCOPe 2.08