![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) ![]() |
![]() | Family d.58.48.0: automated matches [191332] (1 protein) not a true family |
![]() | Protein automated matches [190160] (2 species) not a true protein |
![]() | Species Bacillus cereus [TaxId:226900] [186884] (1 PDB entry) |
![]() | Domain d1yqhb_: 1yqh B: [123887] Other proteins in same PDB: d1yqha1, d1yqha2 automated match to d1vk8a_ |
PDB Entry: 1yqh (more details), 1.7 Å
SCOPe Domain Sequences for d1yqhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yqhb_ d.58.48.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]} msqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldvvkr aqqacvdagaeevitsikihyrpstgvtidekvwkyrdeya
Timeline for d1yqhb_: