Lineage for d1yqhb_ (1yqh B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) (S)
  5. Family d.58.48.0: automated matches [191332] (1 protein)
    not a true family
  6. Protein automated matches [190160] (2 species)
    not a true protein
  7. Species Bacillus cereus [TaxId:226900] [186884] (1 PDB entry)
  8. Domain d1yqhb_: 1yqh B: [123887]
    Other proteins in same PDB: d1yqha1, d1yqha2
    automated match to d1vk8a_

Details for d1yqhb_

PDB Entry: 1yqh (more details), 1.7000000000000002 Å

PDB Description: structure of domain of unknown function duf77 from bacillus cereus
PDB Compounds: (B:) IG hypothetical 16092

SCOPe Domain Sequences for d1yqhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqhb_ d.58.48.0 (B:) automated matches {Bacillus cereus [TaxId: 226900]}
msqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldvvkr
aqqacvdagaeevitsikihyrpstgvtidekvwkyrdeya

SCOPe Domain Coordinates for d1yqhb_ are not available.

Timeline for d1yqhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yqha1, d1yqha2