Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families) |
Family d.58.48.1: MTH1187-like [89958] (5 proteins) Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix |
Protein Hypothetical protein BC0424 [143405] (1 species) |
Species Bacillus cereus [TaxId:1396] [143406] (1 PDB entry) Uniprot Q81IG4 1-101 |
Domain d1yqha1: 1yqh A:1-101 [123886] Other proteins in same PDB: d1yqhb_ |
PDB Entry: 1yqh (more details), 1.7 Å
SCOPe Domain Sequences for d1yqha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yqha1 d.58.48.1 (A:1-101) Hypothetical protein BC0424 {Bacillus cereus [TaxId: 1396]} msqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldvvkr aqqacvdagaeevitsikihyrpstgvtidekvwkyrdeya
Timeline for d1yqha1: