SCOPe 2.08: Domain d1yqha1: 1yqh A:1-101

Lineage for d1yqha1 (1yqh A:1-101)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.48: MTH1187/YkoF-like [89957] (3 families)

5. Family d.58.48.1: MTH1187-like [89958] (5 proteins)
   Pfam PF01910; two domains form a single beta-sheet dimer; two dimers pack sheet-to-sheet in a tetramer; contains extra C-terminal helix

6. Protein Hypothetical protein BC0424 [143405] (1 species)

7. Species Bacillus cereus [TaxId:1396] [143406] (1 PDB entry)
   Uniprot Q81IG4 1-101

8. Domain d1yqha1: 1yqh A:1-101 [123886]
   Other proteins in same PDB: d1yqha2, d1yqhb_

Details for d1yqha1

PDB Entry: 1yqh, 1.7 Å

PDB Description: structure of domain of unknown function duf77 from bacillus cereus

PDB Compounds: (A:) IG hypothetical 16092

SCOPe Domain Sequences for d1yqha1:

Sequence; same for both SEQRES and ATOM records:

>d1yqha1 d.58.48.1 (A:1-101) Hypothetical protein BC0424 {Bacillus cereus [TaxId: 1396]}
msqqvtmsfsvvpqaktkdvysvvdkaievvqqsgvryevgamettlegeldvlldvvkr
aqqacvdagaeevitsikihyrpstgvtidekvwkyrdeya

Timeline for d1yqha1:

• d1yqha1 first appeared in SCOP 1.73
  
• d1yqha1 appears in SCOPe 2.07