| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
| Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
| Protein automated matches [190158] (24 species) not a true protein |
| Species Azotobacter vinelandii [TaxId:354] [186881] (1 PDB entry) |
| Domain d1yobb_: 1yob B: [123777] Other proteins in same PDB: d1yoba1 automated match to d1oboa_ complexed with fmn, so4 |
PDB Entry: 1yob (more details), 2.25 Å
SCOPe Domain Sequences for d1yobb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yobb_ c.23.5.0 (B:) automated matches {Azotobacter vinelandii [TaxId: 354]}
akiglffgsntgktrkvaksikkrfddetmsdalnvnrvsaedfaqyqflilgtptlgeg
elpglssdaenesweeflpkiegldfsgktvalfglgdqvgypenyldalgelysffkdr
gakivgswstdgyefesseavvdgkfvglaldldnqsgktdervaawlaqiapefglsl
Timeline for d1yobb_: