Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1yobb_ (1yob B:)

  1. Root: SCOP 1.75B
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. Protein automated matches [190158] (5 species)
    not a true protein
  7. Species Azotobacter vinelandii [TaxId:354] [186881] (1 PDB entry)
  8. Domain d1yobb_: 1yob B: [123777]
    Other proteins in same PDB: d1yoba1
    automated match to d1oboa_
    complexed with fmn, so4

Details for d1yobb_

PDB Entry: 1yob (more details)
PDB Description: c69a flavodoxin ii from azotobacter vinelandii
PDB Compounds: (B:) Flavodoxin 2

SCOP Domain Sequences for d1yobb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yobb_ c.23.5.0 (B:) automated matches {Azotobacter vinelandii [TaxId: 354]}
akiglffgsntgktrkvaksikkrfddetmsdalnvnrvsaedfaqyqflilgtptlgeg
elpglssdaenesweeflpkiegldfsgktvalfglgdqvgypenyldalgelysffkdr
gakivgswstdgyefesseavvdgkfvglaldldnqsgktdervaawlaqiapefglsl

SCOP Domain Coordinates for d1yobb_:

Click to download the PDB-style file with coordinates for d1yobb_.
(The format of our PDB-style files is described here.)

Timeline for d1yobb_:

d1yobb_ appears in SCOP 1.75A


d1yobb_
(click for larger image)


d1yobb_ in context of chain



d1yobb_ in context of PDB
Domains from other chains:
d1yoba1

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu