Lineage for d1yobb1 (1yob B:1-179)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 691580Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 691939Superfamily c.23.5: Flavoproteins [52218] (8 families) (S)
  5. 691940Family c.23.5.1: Flavodoxin-related [52219] (5 proteins)
    binds FMN
  6. 691941Protein Flavodoxin [52220] (9 species)
  7. 691954Species Azotobacter vinelandii [TaxId:354] [142046] (1 PDB entry)
  8. 691956Domain d1yobb1: 1yob B:1-179 [123777]
    automatically matched to 1YOB A:1-179
    complexed with fmn, so4; mutant

Details for d1yobb1

PDB Entry: 1yob (more details), 2.25 Å

PDB Description: C69A Flavodoxin II from Azotobacter vinelandii
PDB Compounds: (B:) Flavodoxin 2

SCOP Domain Sequences for d1yobb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yobb1 c.23.5.1 (B:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]}
akiglffgsntgktrkvaksikkrfddetmsdalnvnrvsaedfaqyqflilgtptlgeg
elpglssdaenesweeflpkiegldfsgktvalfglgdqvgypenyldalgelysffkdr
gakivgswstdgyefesseavvdgkfvglaldldnqsgktdervaawlaqiapefglsl

SCOP Domain Coordinates for d1yobb1:

Click to download the PDB-style file with coordinates for d1yobb1.
(The format of our PDB-style files is described here.)

Timeline for d1yobb1:

Domains from other chains:
(mouse over for more information)
d1yoba1