| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
| Protein RNA polymerase omega subunit [63564] (3 species) |
| Species Thermus aquaticus [TaxId:271] [63565] (3 PDB entries) |
| Domain d1ynjk1: 1ynj K:1-95 [123741] Other proteins in same PDB: d1ynja1, d1ynja2, d1ynjb1, d1ynjb2, d1ynjc1, d1ynjd1 automatically matched to d1i6ve_ protein/RNA complex; complexed with srn, zn |
PDB Entry: 1ynj (more details), 3.2 Å
SCOPe Domain Sequences for d1ynjk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynjk1 a.143.1.1 (K:1-95) RNA polymerase omega subunit {Thermus aquaticus [TaxId: 271]}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypt
Timeline for d1ynjk1: