Lineage for d1ynjk1 (1ynj K:1-95)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2013114Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2013115Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2013116Family a.143.1.1: RNA polymerase omega subunit [63563] (2 protein domains)
    4 helices; irregular array
  6. 2013117Protein RNA polymerase omega subunit [63564] (3 species)
  7. 2013118Species Thermus aquaticus [TaxId:271] [63565] (3 PDB entries)
  8. 2013119Domain d1ynjk1: 1ynj K:1-95 [123741]
    Other proteins in same PDB: d1ynja1, d1ynja2, d1ynjb1, d1ynjb2, d1ynjc1, d1ynjd1
    automatically matched to d1i6ve_
    protein/RNA complex; complexed with srn, zn

Details for d1ynjk1

PDB Entry: 1ynj (more details), 3.2 Å

PDB Description: Taq RNA polymerase-Sorangicin complex
PDB Compounds: (K:) DNA-directed RNA polymerase omega chain

SCOPe Domain Sequences for d1ynjk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynjk1 a.143.1.1 (K:1-95) RNA polymerase omega subunit {Thermus aquaticus [TaxId: 271]}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypt

SCOPe Domain Coordinates for d1ynjk1:

Click to download the PDB-style file with coordinates for d1ynjk1.
(The format of our PDB-style files is described here.)

Timeline for d1ynjk1: