SCOP 1.73: Domain d1ynjk1: 1ynj K:1-95

Lineage for d1ynjk1 (1ynj K:1-95)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
   core: 2 helices and adjacent loops

4. Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families)
   the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits

5. Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein)
   4 helices; irregular array

6. Protein RNA polymerase omega subunit [63564] (2 species)

7. Species Thermus aquaticus [TaxId:271] [63565] (3 PDB entries)

8. Domain d1ynjk1: 1ynj K:1-95 [123741]
   Other proteins in same PDB: d1ynja1, d1ynja2, d1ynjb1, d1ynjb2
   automatically matched to d1i6ve_
   complexed with srn, zn

Details for d1ynjk1

PDB Entry: 1ynj, 3.2 Å

PDB Description: Taq RNA polymerase-Sorangicin complex

PDB Compounds: (K:) DNA-directed RNA polymerase omega chain

SCOP Domain Sequences for d1ynjk1:

Sequence; same for both SEQRES and ATOM records:

>d1ynjk1 a.143.1.1 (K:1-95) RNA polymerase omega subunit {Thermus aquaticus [TaxId: 271]}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypt

Timeline for d1ynjk1:

• d1ynjk1 is new in SCOP 1.73
  
• d1ynjk1 appears in SCOP 1.75
  
• d1ynjk1 appears in the current release, SCOPe 2.08