|  | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) | 
|  | Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit | 
|  | Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family)  automatically mapped to Pfam PF01000 | 
|  | Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) | 
|  | Protein RNA polymerase alpha subunit [56555] (3 species) | 
|  | Species Thermus aquaticus [TaxId:271] [64461] (4 PDB entries) | 
|  | Domain d1ynja2: 1ynj A:50-172 [123738] Other proteins in same PDB: d1ynja1, d1ynjb1, d1ynjc1, d1ynjd1, d1ynjk1 automatically matched to d1i6va2 protein/RNA complex; complexed with srn, zn | 
PDB Entry: 1ynj (more details), 3.2 Å
SCOPe Domain Sequences for d1ynja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynja2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus aquaticus [TaxId: 271]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkev
ragdftpsadveimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvda
ifs
Timeline for d1ynja2: