Lineage for d1ynja2 (1ynj A:50-172)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2610858Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 2610859Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 2610860Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins)
  6. 2610861Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 2610867Species Thermus aquaticus [TaxId:271] [64461] (4 PDB entries)
  8. 2610868Domain d1ynja2: 1ynj A:50-172 [123738]
    Other proteins in same PDB: d1ynja1, d1ynjb1, d1ynjc1, d1ynjd1, d1ynjk1
    automatically matched to d1i6va2
    protein/RNA complex; complexed with srn, zn

Details for d1ynja2

PDB Entry: 1ynj (more details), 3.2 Å

PDB Description: Taq RNA polymerase-Sorangicin complex
PDB Compounds: (A:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1ynja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynja2 d.181.1.1 (A:50-172) RNA polymerase alpha subunit {Thermus aquaticus [TaxId: 271]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkev
ragdftpsadveimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvda
ifs

SCOPe Domain Coordinates for d1ynja2:

Click to download the PDB-style file with coordinates for d1ynja2.
(The format of our PDB-style files is described here.)

Timeline for d1ynja2: