Class b: All beta proteins [48724] (180 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.2: FHA domain [49885] (12 proteins) |
Protein Polynucleotide kinase 3'-phosphatase [101628] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [101629] (3 PDB entries) |
Domain d1yj5c1: 1yj5 C:6-110 [123384] Other proteins in same PDB: d1yj5a1, d1yj5a2, d1yj5b1, d1yj5b2 complexed with so4 |
PDB Entry: 1yj5 (more details), 2.8 Å
SCOPe Domain Sequences for d1yj5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yj5c1 b.26.1.2 (C:6-110) Polynucleotide kinase 3'-phosphatase {Mouse (Mus musculus) [TaxId: 10090]} srgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesrtvavk qlgvnpstvgvhelkpglsgslslgdvlylvnglypltlrweels
Timeline for d1yj5c1:
View in 3D Domains from other chains: (mouse over for more information) d1yj5a1, d1yj5a2, d1yj5b1, d1yj5b2 |