PDB entry 1yj5

View 1yj5 on RCSB PDB site
Description: Molecular architecture of mammalian polynucleotide kinase, a DNA repair enzyme
Class: Transferase
Keywords: Beta sandwich, P-loop, Transferase
Deposited on 2005-01-13, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5' polynucleotide kinase-3' phosphatase catalytic domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLV6 (Start-382)
      • modified residue (79)
      • modified residue (124)
      • modified residue (325)
      • modified residue (336)
      • modified residue (338)
    Domains in SCOPe 2.07: d1yj5a1, d1yj5a2
  • Chain 'B':
    Compound: 5' polynucleotide kinase-3' phosphatase catalytic domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JLV6 (0-382)
      • modified residue (79)
      • modified residue (124)
      • modified residue (325)
      • modified residue (336)
      • modified residue (338)
    Domains in SCOPe 2.07: d1yj5b1, d1yj5b2
  • Chain 'C':
    Compound: 5' polynucleotide kinase-3' phosphatase FHA domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yj5c1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yj5A (A:)
    rksslgweslkkllvftasgvkpqgkvaafdldgtlittrsgkvfptspsdwrilypeip
    kklqelaaegyklviftnqmgigrgklpaevfkgkveavleklgvpfqvlvathaglnrk
    pvsgmwdhlqeqanegipisvedsvfvgdaagrlanwapgrkkkdfscadrlfalnvglp
    fatpeefflkwpaarfelpafdprtissagplylpesssllspnpevvvavgfpgagkst
    fiqehlvsagyvhvnrdtlgswqrcvsscqaalrqgkrvvidntnpdvpsraryiqcakd
    agvpcrcfnfcatieqarhnnrfremtdpshapvsdmvmfsyrkqfepptlaegfleile
    ipfrlqehldpalqrlyrqfseg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yj5A (A:)
    lgweslkkllvftasgvkpqgkvaafdldgtlittrsgkvfptspsdwrilypeipkklq
    elaaegyklviftnqmgigrgklpaevfkgkveavleklgvpfqvlvathaglnrkpvsg
    mwdhlqeqanegipisvedsvfvgdaagrlanwapgrkkkdfscadrlfalnvglpfatp
    eefflkwpaarfelpafdprtissagplylpesssllspnpevvvavgfpgagkstfiqe
    hlvsagyvhvnrdtlgswqrcvsscqaalrqgkrvvidntnpdvpsraryiqcakdagvp
    crcfnfcatieqarhnnrfremtdpshapvsdmvmfsyrkqfepptlaegfleileipfr
    lqehldpalqrlyrqfseg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yj5B (B:)
    rksslgweslkkllvftasgvkpqgkvaafdldgtlittrsgkvfptspsdwrilypeip
    kklqelaaegyklviftnqmgigrgklpaevfkgkveavleklgvpfqvlvathaglnrk
    pvsgmwdhlqeqanegipisvedsvfvgdaagrlanwapgrkkkdfscadrlfalnvglp
    fatpeefflkwpaarfelpafdprtissagplylpesssllspnpevvvavgfpgagkst
    fiqehlvsagyvhvnrdtlgswqrcvsscqaalrqgkrvvidntnpdvpsraryiqcakd
    agvpcrcfnfcatieqarhnnrfremtdpshapvsdmvmfsyrkqfepptlaegfleile
    ipfrlqehldpalqrlyrqfseg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yj5C (C:)
    msqlgsrgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesr
    tvavkqlgvnpstvgvhelkpglsgslslgdvlylvnglypltlrweelstsgsqpdapp
    dtpgdpeegedtepqkkrvrkss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yj5C (C:)
    srgrlwlqsptggpppiflpsdgqalvlgrgpltqvtdrkcsrnqveliadpesrtvavk
    qlgvnpstvgvhelkpglsgslslgdvlylvnglypltlrweels