Lineage for d1yj5a2 (1yj5 A:351-522)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. Protein 5' polynucleotide kinase-3' phosphatase, C-terminal domain [142213] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [142214] (1 PDB entry)
    Uniprot Q9JLV6 351-522
  8. Domain d1yj5a2: 1yj5 A:351-522 [123381]
    Other proteins in same PDB: d1yj5a1, d1yj5b1, d1yj5c1
    complexed with so4

Details for d1yj5a2

PDB Entry: 1yj5 (more details), 2.8 Å

PDB Description: Molecular architecture of mammalian polynucleotide kinase, a DNA repair enzyme
PDB Compounds: (A:) 5' polynucleotide kinase-3' phosphatase catalytic domain

SCOPe Domain Sequences for d1yj5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
lylpesssllspnpevvvavgfpgagkstfiqehlvsagyvhvnrdtlgswqrcvsscqa
alrqgkrvvidntnpdvpsraryiqcakdagvpcrcfnfcatieqarhnnrfremtdpsh
apvsdmvmfsyrkqfepptlaegfleileipfrlqehldpalqrlyrqfseg

SCOPe Domain Coordinates for d1yj5a2 are not available.

Timeline for d1yj5a2:

Domains from same chain:
(mouse over for more information)
d1yj5a1
Domains from other chains:
(mouse over for more information)
d1yj5b1, d1yj5b2, d1yj5c1