SCOPe 2.08: Domain d1yhca2: 1yhc A:128-279

Lineage for d1yhca2 (1yhc A:128-279)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (2 proteins)
   duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site

6. Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [89829] (18 PDB entries)
   Uniprot O67648 3-270

8. Domain d1yhca2: 1yhc A:128-279 [123169]
   automated match to d1p42a2
   complexed with cac, cl, gol, pam, so4, zn

Details for d1yhca2

PDB Entry: 1yhc, 2.1 Å

PDB Description: crystal structure of aquifex aeolicus lpxc deacetylase complexed with cacodylate

PDB Compounds: (A:) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase

SCOPe Domain Sequences for d1yhca2:

Sequence; same for both SEQRES and ATOM records:

>d1yhca2 d.14.1.7 (A:128-279) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus [TaxId: 63363]}
dyfvveepiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfa
fdweiehikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgsp
vkgkfysfrgghslnvklvkelakkq

Timeline for d1yhca2:

• d1yhca2 first appeared in SCOP 1.73
  
• d1yhca2 appears in SCOPe 2.07