SCOPe 2.08: Domain d1ydxa1: 1ydx A:1-193

Lineage for d1ydxa1 (1ydx A:1-193)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
   comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin

4. Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families)

5. Family d.287.1.2: Type I restriction modification DNA specificity domain [143979] (2 proteins)
   Pfam PF01420

6. Protein Bipartite methylase S protein MG438 [143980] (1 species)
   duplication; contains two structural repeats made of this domain and extra C-terminal coiled coil each; overall structure is similar to MJ0130

7. Species Mycoplasma genitalium [TaxId:2097] [143981] (1 PDB entry)
   Uniprot Q49434 1-193! Uniprot Q49434 194-374

8. Domain d1ydxa1: 1ydx A:1-193 [123004]
   complexed with cl

Details for d1ydxa1

PDB Entry: 1ydx, 2.3 Å

PDB Description: Crystal structure of Type-I restriction-modification system S subunit from M. genitalium

PDB Compounds: (A:) type I restriction enzyme specificity protein MG438

SCOPe Domain Sequences for d1ydxa1:

Sequence; same for both SEQRES and ATOM records:

>d1ydxa1 d.287.1.2 (A:1-193) Bipartite methylase S protein MG438 {Mycoplasma genitalium [TaxId: 2097]}
mtpklklnnninwtkrtidslfdlkkgemlekelitpegkyeyfnggvknsgrtdkfntf
kntisvivggscgyvrladknffcgqsnctlnlldpleldlkfayyalksqqeriealaf
gttiqnirisdlkeleipftsnkneqhaiantlsvfderlenlaslieinrklrdeyahk
lfsldeaflshwk

Timeline for d1ydxa1:

• d1ydxa1 first appeared in SCOP 1.73
  
• d1ydxa1 appears in SCOPe 2.07