Lineage for d1ydxa1 (1ydx A:1-193)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741426Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
    comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin
  4. 741427Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) (S)
  5. 741443Family d.287.1.2: Type I restriction modification DNA specificity domain [143979] (2 proteins)
    Pfam PF01420
  6. 741444Protein Bipartite methylase S protein MG438 [143980] (1 species)
    duplication; contains two structural repeats made of this domain and extra C-terminal coiled coil each; overall structure is similar to MJ0130
  7. 741445Species Mycoplasma genitalium [TaxId:2097] [143981] (1 PDB entry)
  8. 741446Domain d1ydxa1: 1ydx A:1-193 [123004]
    complexed with cl

Details for d1ydxa1

PDB Entry: 1ydx (more details), 2.3 Å

PDB Description: Crystal structure of Type-I restriction-modification system S subunit from M. genitalium
PDB Compounds: (A:) type I restriction enzyme specificity protein MG438

SCOP Domain Sequences for d1ydxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydxa1 d.287.1.2 (A:1-193) Bipartite methylase S protein MG438 {Mycoplasma genitalium [TaxId: 2097]}
mtpklklnnninwtkrtidslfdlkkgemlekelitpegkyeyfnggvknsgrtdkfntf
kntisvivggscgyvrladknffcgqsnctlnlldpleldlkfayyalksqqeriealaf
gttiqnirisdlkeleipftsnkneqhaiantlsvfderlenlaslieinrklrdeyahk
lfsldeaflshwk

SCOP Domain Coordinates for d1ydxa1:

Click to download the PDB-style file with coordinates for d1ydxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ydxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ydxa2