Lineage for d1ydxa2 (1ydx A:194-374)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009817Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
    comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin
  4. 3009818Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) (S)
  5. 3009846Family d.287.1.2: Type I restriction modification DNA specificity domain [143979] (2 proteins)
    Pfam PF01420
  6. 3009847Protein Bipartite methylase S protein MG438 [143980] (1 species)
    duplication; contains two structural repeats made of this domain and extra C-terminal coiled coil each; overall structure is similar to MJ0130
  7. 3009848Species Mycoplasma genitalium [TaxId:2097] [143981] (1 PDB entry)
    Uniprot Q49434 1-193! Uniprot Q49434 194-374
  8. 3009850Domain d1ydxa2: 1ydx A:194-374 [123005]
    complexed with cl

Details for d1ydxa2

PDB Entry: 1ydx (more details), 2.3 Å

PDB Description: Crystal structure of Type-I restriction-modification system S subunit from M. genitalium
PDB Compounds: (A:) type I restriction enzyme specificity protein MG438

SCOPe Domain Sequences for d1ydxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ydxa2 d.287.1.2 (A:194-374) Bipartite methylase S protein MG438 {Mycoplasma genitalium [TaxId: 2097]}
lealqsqmheitlgeifnfksgkylkseerleegkfpyygagidntgfvaepntekdtis
iisngyslgniryheipwfngtgsialepmnneiyvpffycalkylqkdikermksddsp
flslklageikvpyvksfqlqrkagkivflldqkldqykkelssltvirdtllkklfpdm
t

SCOPe Domain Coordinates for d1ydxa2:

Click to download the PDB-style file with coordinates for d1ydxa2.
(The format of our PDB-style files is described here.)

Timeline for d1ydxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ydxa1