PDB entry 1ydx

View 1ydx on RCSB PDB site
Description: Crystal structure of Type-I restriction-modification system S subunit from M. genitalium
Class: DNA binding protein
Keywords: type-I hsds, DNA binding protein
Deposited on 2004-12-27, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.199
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: type I restriction enzyme specificity protein MG438
    Species: Mycoplasma genitalium [TaxId:2097]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q49434 (23-End)
      • modified residue (23)
      • modified residue (51)
      • modified residue (223)
      • modified residue (305)
      • modified residue (329)
      • modified residue (395)
    Domains in SCOPe 2.07: d1ydxa1, d1ydxa2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ydxA (A:)
    mghhhhhhhhhhssghiddddkhmtpklklnnninwtkrtidslfdlkkgemlekelitp
    egkyeyfnggvknsgrtdkfntfkntisvivggscgyvrladknffcgqsnctlnlldpl
    eldlkfayyalksqqeriealafgttiqnirisdlkeleipftsnkneqhaiantlsvfd
    erlenlaslieinrklrdeyahklfsldeaflshwklealqsqmheitlgeifnfksgky
    lkseerleegkfpyygagidntgfvaepntekdtisiisngyslgniryheipwfngtgs
    ialepmnneiyvpffycalkylqkdikermksddspflslklageikvpyvksfqlqrka
    gkivflldqkldqykkelssltvirdtllkklfpdmtertksikdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ydxA (A:)
    mtpklklnnninwtkrtidslfdlkkgemlekelitpegkyeyfnggvknsgrtdkfntf
    kntisvivggscgyvrladknffcgqsnctlnlldpleldlkfayyalksqqeriealaf
    gttiqnirisdlkeleipftsnkneqhaiantlsvfderlenlaslieinrklrdeyahk
    lfsldeaflshwklealqsqmheitlgeifnfksgkylkseerleegkfpyygagidntg
    fvaepntekdtisiisngyslgniryheipwfngtgsialepmnneiyvpffycalkylq
    kdikermksddspflslklageikvpyvksfqlqrkagkivflldqkldqykkelssltv
    irdtllkklfpdmt