Lineage for d1yaed1 (1yae D:423-544,D:668-804)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913863Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2914279Species Norway rat (Rattus norvegicus), GluR6 [TaxId:10116] [142801] (3 PDB entries)
    Uniprot P42260 421-544,668-804! Uniprot P42260 429-544,667-806
  8. 2914285Domain d1yaed1: 1yae D:423-544,D:668-804 [122812]
    automatically matched to 1YAE A:421-544,A:668-804
    complexed with doq, nag

Details for d1yaed1

PDB Entry: 1yae (more details), 3.11 Å

PDB Description: structure of the kainate receptor subunit glur6 agonist binding domain complexed with domoic acid
PDB Compounds: (D:) Glutamate receptor, ionotropic kainate 2

SCOPe Domain Sequences for d1yaed1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yaed1 c.94.1.1 (D:423-544,D:668-804) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR6 [TaxId: 10116]}
nitdslsnrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirl
vedgkygaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisily
rkXidsaddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneeg
iqrvltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailq
lqeegklhmmkekwwrgngc

SCOPe Domain Coordinates for d1yaed1:

Click to download the PDB-style file with coordinates for d1yaed1.
(The format of our PDB-style files is described here.)

Timeline for d1yaed1: