Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
Protein Glutamate receptor ligand binding core [53881] (5 species) |
Species Norway rat (Rattus norvegicus), GluR6 [TaxId:10116] [142801] (3 PDB entries) Uniprot P42260 421-544,668-804! Uniprot P42260 429-544,667-806 |
Domain d1yaea1: 1yae A:421-544,A:668-804 [122809] complexed with doq, nag |
PDB Entry: 1yae (more details), 3.11 Å
SCOPe Domain Sequences for d1yaea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yaea1 c.94.1.1 (A:421-544,A:668-804) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR6 [TaxId: 10116]} panitdslsnrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyei rlvedgkygaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisi lyrkXidsaddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksne egiqrvltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiai lqlqeegklhmmkekwwrgngc
Timeline for d1yaea1:
View in 3D Domains from other chains: (mouse over for more information) d1yaeb1, d1yaec1, d1yaed1, d1yaee1 |