![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein Glutamate receptor ligand binding core [53881] (5 species) |
![]() | Species Norway rat (Rattus norvegicus), GluR6 [TaxId:10116] [142801] (3 PDB entries) Uniprot P42260 421-544,668-804! Uniprot P42260 429-544,667-806 |
![]() | Domain d1yaee1: 1yae E:423-544,E:668-801 [122813] automatically matched to 1YAE A:421-544,A:668-804 complexed with doq, nag |
PDB Entry: 1yae (more details), 3.11 Å
SCOPe Domain Sequences for d1yaee1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yaee1 c.94.1.1 (E:423-544,E:668-801) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR6 [TaxId: 10116]} nitdslsnrslivttileepyvlfkksdkplygndrfegycidllrelstilgftyeirl vedgkygaqddvngqwngmvrelidhkadlavaplaityvrekvidfskpfmtlgisily rkXidsaddlakqtkieygavedgatmtffkkskistydkmwafmssrrqsvlvksneeg iqrvltsdyaflmesttiefvtqrncnltqigglidskgygvgtpmgspyrdkitiailq lqeegklhmmkekwwrg
Timeline for d1yaee1:
![]() Domains from other chains: (mouse over for more information) d1yaea1, d1yaeb1, d1yaec1, d1yaed1 |