Lineage for d1y64a2 (1y64 A:147-372)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605037Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1605420Protein automated matches [226905] (11 species)
    not a true protein
  7. 1605509Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (9 PDB entries)
  8. 1605525Domain d1y64a2: 1y64 A:147-372 [122658]
    Other proteins in same PDB: d1y64a1, d1y64b_
    automated match to d1c0fa2
    complexed with atp, ca

Details for d1y64a2

PDB Entry: 1y64 (more details), 3.05 Å

PDB Description: Bni1p Formin Homology 2 Domain complexed with ATP-actin
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d1y64a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y64a2 c.55.1.1 (A:147-372) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhr

SCOPe Domain Coordinates for d1y64a2:

Click to download the PDB-style file with coordinates for d1y64a2.
(The format of our PDB-style files is described here.)

Timeline for d1y64a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y64a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1y64b_