SCOPe 2.04: Domain d1y64a1: 1y64 A:4-146

Lineage for d1y64a1 (1y64 A:4-146)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (8 PDB entries)

8. Domain d1y64a1: 1y64 A:4-146 [122657]
   Other proteins in same PDB: d1y64a2, d1y64b_
   automated match to d1c0fa1
   complexed with atp, ca

Details for d1y64a1

PDB Entry: 1y64, 3.05 Å

PDB Description: Bni1p Formin Homology 2 Domain complexed with ATP-actin

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d1y64a1:

Sequence, based on SEQRES records:

>d1y64a1 c.55.1.0 (A:4-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records):

>d1y64a1 c.55.1.0 (A:4-146) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ettalvcdngsglvkagfagddapravfpsivgrprsyvgdeaqskrgiltlkypiehgi
itnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyva
iqavlslyasg

Timeline for d1y64a1:

• d1y64a1 first appeared in SCOP 1.73
  
• d1y64a1 appears in SCOPe 2.03
  
• d1y64a1 appears in SCOPe 2.05
  
• d1y64a1 appears in the current release, SCOPe 2.08