SCOPe 2.08: Domain d1y64a2: 1y64 A:147-372

Lineage for d1y64a2 (1y64 A:147-372)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (15 PDB entries)

8. Domain d1y64a2: 1y64 A:147-372 [122658]
   Other proteins in same PDB: d1y64a1, d1y64b_
   automated match to d1c0fa2
   complexed with atp, ca

Details for d1y64a2

PDB Entry: 1y64, 3.05 Å

PDB Description: Bni1p Formin Homology 2 Domain complexed with ATP-actin

PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d1y64a2:

Sequence; same for both SEQRES and ATOM records:

>d1y64a2 c.55.1.1 (A:147-372) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhr

Timeline for d1y64a2:

• d1y64a2 first appeared in SCOP 1.73
  
• d1y64a2 appears in SCOPe 2.07