SCOPe 2.08: Domain d1xrta1: 1xrt A:1-55,A:366-422

Lineage for d1xrta1 (1xrt A:1-55,A:366-422)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)

6. Protein Two-domain dihydroorotase [141686] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [141687] (2 PDB entries)
   Uniprot O66990 1-55,366-422

8. Domain d1xrta1: 1xrt A:1-55,A:366-422 [122258]
   Other proteins in same PDB: d1xrta2, d1xrtb2, d1xrtb3
   automated match to d1xrfa1
   complexed with zn

Details for d1xrta1

PDB Entry: 1xrt, 1.61 Å

PDB Description: The Crystal Structure of a Novel, Latent Dihydroorotase from Aquifex Aeolicus at 1.7 A Resolution

PDB Compounds: (A:) dihydroorotase

SCOPe Domain Sequences for d1xrta1:

Sequence; same for both SEQRES and ATOM records:

>d1xrta1 b.92.1.3 (A:1-55,A:366-422) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]}
mlklivkngyvidpsqnlegefdilvengkikkidknilvpeaeiidakglivcpXtlkl
gspaditifdpnkewilneetnlsksrntplwgkvlkgkviytikdgkmvykd

Timeline for d1xrta1:

• d1xrta1 first appeared in SCOP 1.73
  
• d1xrta1 appears in SCOPe 2.07