Lineage for d1xrfa1 (1xrf A:1-55,A:366-422)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819141Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 2819142Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 2819203Family b.92.1.3: Hydantoinase (dihydropyrimidinase) [75044] (5 proteins)
  6. 2819259Protein Two-domain dihydroorotase [141686] (1 species)
  7. 2819260Species Aquifex aeolicus [TaxId:63363] [141687] (2 PDB entries)
    Uniprot O66990 1-55,366-422
  8. 2819263Domain d1xrfa1: 1xrf A:1-55,A:366-422 [122254]
    Other proteins in same PDB: d1xrfa2, d1xrfa3
    complexed with so4, zn

Details for d1xrfa1

PDB Entry: 1xrf (more details), 1.65 Å

PDB Description: the crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
PDB Compounds: (A:) dihydroorotase

SCOPe Domain Sequences for d1xrfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrfa1 b.92.1.3 (A:1-55,A:366-422) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]}
mlklivkngyvidpsqnlegefdilvengkikkidknilvpeaeiidakglivcpXtlkl
gspaditifdpnkewilneetnlsksrntplwgkvlkgkviytikdgkmvykd

SCOPe Domain Coordinates for d1xrfa1:

Click to download the PDB-style file with coordinates for d1xrfa1.
(The format of our PDB-style files is described here.)

Timeline for d1xrfa1: