Lineage for d1xrfa2 (1xrf A:56-365)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 proteins)
    automatically mapped to Pfam PF13147
  6. Protein Two-domain dihydroorotase [141803] (1 species)
  7. Species Aquifex aeolicus [TaxId:63363] [141804] (2 PDB entries)
    Uniprot O66990 56-365
  8. Domain d1xrfa2: 1xrf A:56-365 [122255]
    Other proteins in same PDB: d1xrfa1, d1xrfa3
    complexed with so4, zn

Details for d1xrfa2

PDB Entry: 1xrf (more details), 1.6500000000000001 Å

PDB Description: the crystal structure of a novel, latent dihydroorotase from aquifex aeolicus at 1.7 a resolution
PDB Compounds: (A:) dihydroorotase

SCOPe Domain Sequences for d1xrfa2:

Sequence, based on SEQRES records: (download)

>d1xrfa2 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]}
gfidihvhlrdpgqtykediesgsrcavaggfttivcmpntnppidnttvvnyilqksks
vglcrvlptgtitkgrkgkeiadfyslkeagcvaftddgspvmdssvmrkalelasqlgv
pimdhceddklaygvinegevsallglssrapeaeeiqiardgilaqrtgghvhiqhvst
klsleiieffkekgvkitcevnpnhllfterevlnsganarvnpplrkkedrlaliegvk
rgiidcfatdhaphqtfekelvefampgiiglqtalpsalelyrkgiislkkliemftin
pariigvdlg

Sequence, based on observed residues (ATOM records): (download)

>d1xrfa2 c.1.9.6 (A:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]}
gfidihvhlrdpgqtykediesgsrcavaggfttivcmpntnppidnttvvnyilqksks
vglcrvlptgtitkgrkgkeiadfyslkeagcvaftddgspvmdssvmrkalelasqlgv
pimdhaeeiqiardgilaqrtgghvhiqhvstklsleiieffkekgvkitcevnpnhlld
rlaliegvkrgiidcfatdhaphqtmpgiiglqtalpsalelyrkgiislkkliemftin
pariigvdlg

SCOPe Domain Coordinates for d1xrfa2 are not available.

Timeline for d1xrfa2:

Domains from same chain:
(mouse over for more information)
d1xrfa1, d1xrfa3