Lineage for d1xrtb2 (1xrt B:56-365)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084618Family c.1.9.6: Hydantoinase (dihydropyrimidinase), catalytic domain [75073] (5 protein domains)
    automatically mapped to Pfam PF13147
  6. 2084674Protein Two-domain dihydroorotase [141803] (1 species)
  7. 2084675Species Aquifex aeolicus [TaxId:63363] [141804] (2 PDB entries)
    Uniprot O66990 56-365
  8. 2084677Domain d1xrtb2: 1xrt B:56-365 [122261]
    Other proteins in same PDB: d1xrta1, d1xrtb1, d1xrtb3
    automated match to d1xrfa2
    complexed with zn

Details for d1xrtb2

PDB Entry: 1xrt (more details), 1.61 Å

PDB Description: The Crystal Structure of a Novel, Latent Dihydroorotase from Aquifex Aeolicus at 1.7 A Resolution
PDB Compounds: (B:) dihydroorotase

SCOPe Domain Sequences for d1xrtb2:

Sequence, based on SEQRES records: (download)

>d1xrtb2 c.1.9.6 (B:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]}
gfidihvhlrdpgqtykediesgsrcavaggfttivcmpntnppidnttvvnyilqksks
vglcrvlptgtitkgrkgkeiadfyslkeagcvaftddgspvmdssvmrkalelasqlgv
pimdhceddklaygvinegevsallglssrapeaeeiqiardgilaqrtgghvhiqhvst
klsleiieffkekgvkitcevnpnhllfterevlnsganarvnpplrkkedrlaliegvk
rgiidcfatdhaphqtfekelvefampgiiglqtalpsalelyrkgiislkkliemftin
pariigvdlg

Sequence, based on observed residues (ATOM records): (download)

>d1xrtb2 c.1.9.6 (B:56-365) Two-domain dihydroorotase {Aquifex aeolicus [TaxId: 63363]}
gfidihvhlrdpgqtykediesgsrcavaggfttivcmpntnppidnttvvnyilqksks
vglcrvlptgtitkgrkgkeiadfyslkeagcvaftddgspvmdssvmrkalelasqlgv
pimdhceddklaeaeeiqiardgilaqrtgghvhiqhvstklsleiieffkekgvkitce
vnpnhllrlaliegvkrgiidcfatdhaphqtpgiiglqtalpsalelyrkgiislkkli
emftinpariigvdlg

SCOPe Domain Coordinates for d1xrtb2:

Click to download the PDB-style file with coordinates for d1xrtb2.
(The format of our PDB-style files is described here.)

Timeline for d1xrtb2: